Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)

Source: Human Cells. MW :42.2kD. Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc, 6His tag at the C-terminus. ALK-3 is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the protein kinase superfamily, TKL Ser/Thr protein kinase family and TGFB receptor subfamily. The BMP receptors consists of the type I receptors BMPR1A and BMPR1B and the type I I receptor BMPR2. Seven known type I serine/threonine kinases and five mammalian type II serine/threonine kinase receptors function in TGF-beta superfamily signal transduction. The downstream molecules of the type I BMP receptors include the Smad (Smad1, 5 and 8) proteins that are phosphorylated in a ligand-dependent manner, and relay the BMP signal from the receptors to target genes in the nucleus. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ALK-3 contains a GS domain and a protein kinase domain. ALK-3 is widely expressed. Defects in BMPR1A gene are a cause of a significant proportion of cases of Juvenile polyposis syndrome (JPS) .

Product Specifications

Gene Name

Bmpr1a

Gene ID

12166

UniProt

P36895

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human GRIK5 shRNA (UAS) - Lentiviral human GRIK5 shRNA (UAS) (25)
GTR15338264 1 Vial

Lentiviral human GRIK5 shRNA (UAS) - Lentiviral human GRIK5 shRNA (UAS) (25)

Ask
View Details
Lentiviral mouse Wdr86 shRNA (UAS) - Lentiviral mouse Wdr86 shRNA (UAS, RFP) (25)
GTR15262067 1 Vial

Lentiviral mouse Wdr86 shRNA (UAS) - Lentiviral mouse Wdr86 shRNA (UAS, RFP) (25)

Ask
View Details
Nociceptin receptor (OPRL1) Human shRNA Lentiviral Particle (Locus ID 4987)
TL311014V 500 µL Each

Nociceptin receptor (OPRL1) Human shRNA Lentiviral Particle (Locus ID 4987)

Ask
View Details
Rat IL7 (Interleukin 7) ELISA Kit
ELK2245-01 48 Tests

Rat IL7 (Interleukin 7) ELISA Kit

Ask
View Details
Rat IL7 (Interleukin 7) ELISA Kit
ELK2245-02 96 Tests

Rat IL7 (Interleukin 7) ELISA Kit

Ask
View Details
Rat IL7 (Interleukin 7) ELISA Kit
ELK2245-03 5x 96 Tests

Rat IL7 (Interleukin 7) ELISA Kit

Ask
View Details