Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)

Source: Human Cells. MW :42.2kD. Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc, 6His tag at the C-terminus. ALK-3 is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the protein kinase superfamily, TKL Ser/Thr protein kinase family and TGFB receptor subfamily. The BMP receptors consists of the type I receptors BMPR1A and BMPR1B and the type I I receptor BMPR2. Seven known type I serine/threonine kinases and five mammalian type II serine/threonine kinase receptors function in TGF-beta superfamily signal transduction. The downstream molecules of the type I BMP receptors include the Smad (Smad1, 5 and 8) proteins that are phosphorylated in a ligand-dependent manner, and relay the BMP signal from the receptors to target genes in the nucleus. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ALK-3 contains a GS domain and a protein kinase domain. ALK-3 is widely expressed. Defects in BMPR1A gene are a cause of a significant proportion of cases of Juvenile polyposis syndrome (JPS) .

Product Specifications

Gene Name

Bmpr1a

Gene ID

12166

UniProt

P36895

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ABP1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-4731R-BF555 100 µL

ABP1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
Mouse Hrh3 qPCR Primer Pair
QM07714S 200 Tests

Mouse Hrh3 qPCR Primer Pair

Ask
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (HRP)
MBS6243698-01 0.1 mL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (HRP)

Ask
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (HRP)
MBS6243698-02 5x 0.1 mL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (HRP)

Ask
View Details