Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor Tyrosine Kinase MerTK/MERTK/MER (C-6His)

Source: Human Cells. MW :36kD. Recombinant Human Tyrosine-protein kinase Mer is produced by our Mammalian expression system and the target gene encoding Met177-Ala499 is expressed with a 6His tag at the C-terminus. Tyrosine-protein kinase Mer (MERTK) is a single-pass type I membrane protein which belongs to the MER/AXL/TYRO3 receptor kinase family. MERTK include two fibronectin type-III domains, two Ig-like C2-type domains, and one tyrosine kinase domain. It canâ€TMt be expressed in normal B- and T-lymphocytes, but it is usually expressed in numerous neoplastic B- and T-cell lines. MERTK could regulate many physiological processes, such as cell survival, migration, differentiation. It was demonstrated that the MERTK plays critical role in the engulfment and efficient clearance of apoptotic cells, platelet aggregation, and cytoskeleton reorganization. Not only these, it also plays an important role in inhibition of Toll-like receptors (TLRs) -mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3. In addition, MERTK could regulate rod outer segments fragments phagocytosis in the retinal pigment epithelium (RPE), deficiency in MERTK are the cause of retinitis pigmentosa.

Product Specifications

Gene Name

MERTK

Gene ID

10461

UniProt

Q12866

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACE2 Mouse Monoclonal Antibody [Clone ID: OTI1D6] (Angiotensin Converting Enzyme 2)
TA803906S 30 µL

ACE2 Mouse Monoclonal Antibody [Clone ID: OTI1D6] (Angiotensin Converting Enzyme 2)

Ask
View Details
IgG3 (Immunoglobulin G3) Human ELISA Kit
E1923 96 Tests

IgG3 (Immunoglobulin G3) Human ELISA Kit

Ask
View Details
Recombinant Human GM-CSF
SJA01-04 50µg/vial

Recombinant Human GM-CSF

Ask
View Details
Lucatumumab Biosimilar - Research Grade
MBS3030491-01 1 mg

Lucatumumab Biosimilar - Research Grade

Ask
View Details
Lucatumumab Biosimilar - Research Grade
MBS3030491-02 5 mg

Lucatumumab Biosimilar - Research Grade

Ask
View Details
Lucatumumab Biosimilar - Research Grade
MBS3030491-03 10 mg

Lucatumumab Biosimilar - Research Grade

Ask
View Details