Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin/Acrp30/AdipoQ (C-6His, Human Cells)

Source: Human Cells. MW :27.6kD. Recombinant Mouse Adiponectin is produced by our Mammalian expression system and the target gene encoding Glu18-Asn247 is expressed with a 6His tag at the C-terminus. Adiponectin is a secreted protein. It is synthesized exclusively by adipocytes and secreted into plasma. Adiponectin is an important adipokine that is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin Stimulates AMPK phosphorylation and activates in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Adiponectin also antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. It inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin may play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex: LMW, MMW or HMW.

Product Specifications

Gene Name

Adipoq

Gene ID

11450

UniProt

Q60994

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human GPX7 Protein, N-His
HA955012-01 50 µg

Recombinant Human GPX7 Protein, N-His

Ask
View Details
Recombinant Human GPX7 Protein, N-His
HA955012-02 100 µg

Recombinant Human GPX7 Protein, N-His

Ask
View Details
Recombinant Human GPX7 Protein, N-His
HA955012-03 1 mg

Recombinant Human GPX7 Protein, N-His

Ask
View Details
Mouse Hoxb6 Rabbit Polyclonal Antibody (N-term)
E28PB1691 100 µL

Mouse Hoxb6 Rabbit Polyclonal Antibody (N-term)

Ask
View Details
Human carbohydrate antigen724, CA724 ELISA Kit
MBS165008-01 48 Well

Human carbohydrate antigen724, CA724 ELISA Kit

Ask
View Details
Human carbohydrate antigen724, CA724 ELISA Kit
MBS165008-02 96 Well

Human carbohydrate antigen724, CA724 ELISA Kit

Ask
View Details