Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ganglioside GM2 Activator/GM2A (C-6His)

Source: Human Cells. MW :18.6kD. Recombinant Human Ganglioside GM2 activator is produced by our Mammalian expression system and the target gene encoding Ser32-Ile193 is expressed with a 6His tag at the C-terminus. Ganglioside GM2 activator (GM2A) is a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A (HEXB) . HEXB together with GM2A, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. GM2A accommodate several single chain phospholipids and fatty acids, is a lipid transfer protein that stimulates the enzymatic processing of gangliosides, and also T-cell activation through lipid presentation. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3.

Product Specifications

Gene Name

GM2A

Gene ID

2760

UniProt

P17900

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl, pH7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Ttc25 shRNA (UAS) - Lentiviral mouse Ttc25 shRNA (UAS) plasmid
GTR15281935 1 Vial

Lentiviral mouse Ttc25 shRNA (UAS) - Lentiviral mouse Ttc25 shRNA (UAS) plasmid

Ask
View Details
Human TRIM6-TRIM34 Knockout HEK293T cell line
GTR15418984 1 Vial

Human TRIM6-TRIM34 Knockout HEK293T cell line

Ask
View Details
ornithine aminotransferase (OAT) (NM_001171814) Human Tagged Lenti ORF Clone
RC229852L3 10 µg

ornithine aminotransferase (OAT) (NM_001171814) Human Tagged Lenti ORF Clone

Ask
View Details
Glypican 3 (GPC3) CytoSection
TS405911P5 25 Slides

Glypican 3 (GPC3) CytoSection

Ask
View Details