Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin Protein P0-like 1/MPZL1 (C-6His)

Source: Human Cells. MW :15.2kD. Recombinant Human Myelin Protein P0-like 1 is produced by our Mammalian expression system and the target gene encoding Ser36-Val162 is expressed with a 6His tag at the C-terminus. Myelin protein zero-like protein 1 (MPZL1) is encoded by the MPZL1 gene, which is a single-pass type I membrane protein. It is widely expressed with highest levels in heart, placenta, kidney and pancreas. As cell surface receptor, it involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and subsequently activate/phosphorylate Src kinase at Tyr426, promoting phosphorylation of cortactin and migration of HCC cells. MPZL1also is a major receptor for concanavalin-A (ConA) and involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases.

Product Specifications

Gene Name

MPZL1

Gene ID

9019

UniProt

O95297

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBAP2L (NM_014847) Human Tagged Lenti ORF Clone
RC201371L3 10 µg

UBAP2L (NM_014847) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MT-ATP8 Antibody
MBS9520427-01 0.04 mL

MT-ATP8 Antibody

Sign In for Pricing
View Details
MT-ATP8 Antibody
MBS9520427-02 0.1 mL

MT-ATP8 Antibody

Sign In for Pricing
View Details
MT-ATP8 Antibody
MBS9520427-03 0.2 mL

MT-ATP8 Antibody

Sign In for Pricing
View Details
MT-ATP8 Antibody
MBS9520427-04 5x 0.2 mL

MT-ATP8 Antibody

Sign In for Pricing
View Details
(6-Bromopyridin-3-yl) methanol
234592-01 1 g

(6-Bromopyridin-3-yl) methanol

Sign In for Pricing
View Details