Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin Protein P0-like 1/MPZL1 (C-6His)

Source: Human Cells. MW :15.2kD. Recombinant Human Myelin Protein P0-like 1 is produced by our Mammalian expression system and the target gene encoding Ser36-Val162 is expressed with a 6His tag at the C-terminus. Myelin protein zero-like protein 1 (MPZL1) is encoded by the MPZL1 gene, which is a single-pass type I membrane protein. It is widely expressed with highest levels in heart, placenta, kidney and pancreas. As cell surface receptor, it involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and subsequently activate/phosphorylate Src kinase at Tyr426, promoting phosphorylation of cortactin and migration of HCC cells. MPZL1also is a major receptor for concanavalin-A (ConA) and involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases.

Product Specifications

Gene Name

MPZL1

Gene ID

9019

UniProt

O95297

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp712 siRNA Oligos set (Mouse)
51103174 3x 5 nmol

Zfp712 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
ADIPOR1 Rabbit pAb
MBS9142347-01 0.02 mL

ADIPOR1 Rabbit pAb

Sign In for Pricing
View Details
ADIPOR1 Rabbit pAb
MBS9142347-02 0.1 mL

ADIPOR1 Rabbit pAb

Sign In for Pricing
View Details
ADIPOR1 Rabbit pAb
MBS9142347-03 5x 0.1 mL

ADIPOR1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human Programmed Cell Death 6
7-05835 1 mg

Recombinant Human Programmed Cell Death 6

Sign In for Pricing
View Details
Brilliant Violet 510™ anti-human CD16
GT07251 25 Tests

Brilliant Violet 510™ anti-human CD16

Sign In for Pricing
View Details