Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 6-Phosphogluconate Dehydrogenase, Decarboxylating/PGD (C-6His)

Source: Human Cells. MW :54.2kD. Recombinant Human 6PGD is produced by our Mammalian expression system and the target gene encoding Met1-Ala483 is expressed with a 6His tag at the C-terminus. 6-phosphogluconate dehydrogenase (PGD) is a cytoplasm-located protein, and belongs to the 6-phosphogluconate dehydrogenase family. 6PGD is the second dehydrogenase in the pentose phosphate shunt. It catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO2, with concomitant reduction of NADP to NADPH. Mutations within the gene coding this enzyme result in 6-phosphogluconate dehydrogenase deficiency, an autosomal hereditary disease effecting the red blood cells.

Product Specifications

Gene Name

PGD

Gene ID

5226

UniProt

P52209

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GLEPP1 (PTPRO) (NM_030671) Human Over-expression Lysate
LC410739 20 µg

GLEPP1 (PTPRO) (NM_030671) Human Over-expression Lysate

Ask
View Details
Mucin 2 (MUC2 Glycoprotein)(BSA & Azide Free)
MBS6507977-01 0.1 mL

Mucin 2 (MUC2 Glycoprotein)(BSA & Azide Free)

Ask
View Details
Mucin 2 (MUC2 Glycoprotein)(BSA & Azide Free)
MBS6507977-02 5x 0.1 mL

Mucin 2 (MUC2 Glycoprotein)(BSA & Azide Free)

Ask
View Details
Rat Deoxycytidine kinase ELISA Kit
MBS9428670-01 96 Tests

Rat Deoxycytidine kinase ELISA Kit

Ask
View Details
Rat Deoxycytidine kinase ELISA Kit
MBS9428670-02 5x 96 Tests

Rat Deoxycytidine kinase ELISA Kit

Ask
View Details
ZNF485 Protein Vector (Human) (pPM-C-HA)
51553021 500 ng

ZNF485 Protein Vector (Human) (pPM-C-HA)

Ask
View Details