Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-9/MMP-9 (C-6His)

Source: Human Cells. MW :77.4kD. Recombinant Human Matrix metalloproteinase-9 is produced by our Mammalian expression system and the target gene encoding Ala19-Asp707 is expressed with a 6His tag at the C-terminus. Matrix metallopeptidase 9 (MMP-9) is an enzyme encoded by the MMP9 gene. This protein, which is produced by normal alveolar macrophages and granulocytes, can be activated by 4-aminophenylmercuric acetate and phorbol ester and up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. MMP-9 is involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, angiogenesis, bone development, wound healing, cell migration, learning and memory, as well as in pathological processes, such as arthritis, intracerebral hemorrhage, and metastasis.

Product Specifications

Gene Name

MMP9

Gene ID

4318

UniProt

P14780

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 2mM CaCl2, 150mM NaCl, 0.05% Brij35 (w/v), pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : The specific activity is >1,100 pmol/min/μg. Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 .

Amino Acids

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tsc22d1 (NM_001177751) Mouse Tagged Lenti ORF Clone
MR223063L3 10 µg

Tsc22d1 (NM_001177751) Mouse Tagged Lenti ORF Clone

Ask
View Details
Rabbit Anti-Actinin-α2/3/ACTN2 Polyclonal Antibody
PAV4691 100 μL

Rabbit Anti-Actinin-α2/3/ACTN2 Polyclonal Antibody

Ask
View Details
Plant Heat Shock Protein Glycoprotein 96 (HSP-GP96) ELISA Kit
MBS9379945 Inquire

Plant Heat Shock Protein Glycoprotein 96 (HSP-GP96) ELISA Kit

Ask
View Details
IL15 Human shRNA Plasmid Kit (Locus ID 3600)
TR303963 1 Kit

IL15 Human shRNA Plasmid Kit (Locus ID 3600)

Ask
View Details
Recombinant Mouse RNA-binding protein Nova-1 (Nova1)
MBS1338465-01 0.02 mg (E-Coli)

Recombinant Mouse RNA-binding protein Nova-1 (Nova1)

Ask
View Details
Recombinant Mouse RNA-binding protein Nova-1 (Nova1)
MBS1338465-02 0.02 mg (Yeast)

Recombinant Mouse RNA-binding protein Nova-1 (Nova1)

Ask
View Details