Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-9/MMP-9 (C-6His)

Source: Human Cells. MW :77.4kD. Recombinant Human Matrix metalloproteinase-9 is produced by our Mammalian expression system and the target gene encoding Ala19-Asp707 is expressed with a 6His tag at the C-terminus. Matrix metallopeptidase 9 (MMP-9) is an enzyme encoded by the MMP9 gene. This protein, which is produced by normal alveolar macrophages and granulocytes, can be activated by 4-aminophenylmercuric acetate and phorbol ester and up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. MMP-9 is involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, angiogenesis, bone development, wound healing, cell migration, learning and memory, as well as in pathological processes, such as arthritis, intracerebral hemorrhage, and metastasis.

Product Specifications

Gene Name

MMP9

Gene ID

4318

UniProt

P14780

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 2mM CaCl2, 150mM NaCl, 0.05% Brij35 (w/v), pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : The specific activity is >1,100 pmol/min/μg. Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 .

Amino Acids

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Tubgcp5 shRNA (UAS) - Lentiviral mouse Tubgcp5 shRNA (UAS) (100)
GTR15162858 1 Vial

Lentiviral mouse Tubgcp5 shRNA (UAS) - Lentiviral mouse Tubgcp5 shRNA (UAS) (100)

Ask
View Details
ICAM1 Antibody
GWB-92A943 0.1 mg

ICAM1 Antibody

Ask
View Details
PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 650)
MBS6336497-01 0.1 mL

PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 650)

Ask
View Details
PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 650)
MBS6336497-02 5x 0.1 mL

PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 650)

Ask
View Details