Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma Receptor 1/IFNGR1 (C-6His)

Source: Human Cells. MW :28.7kD. Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus. Interferon gamma receptor 1 (IFNGR1) encoded by the IFNGR1 gene, is a single-pass type 1 membrane protein which belongs to the type II cytokine receptor family. IFNGR1 is phosphorylated at Ser/Thr residues after translation. IFNGR1 is a receptor for interferon gamma, two receptors bind one interferon gama dimer. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Product Specifications

Gene Name

IFNGR1

Gene ID

3459

UniProt

P15260

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Prothymosin Alpha, PTMa ELISA KIT
E0798Mo-01 48 Well

Mouse Prothymosin Alpha, PTMa ELISA KIT

Ask
View Details
Mouse Prothymosin Alpha, PTMa ELISA KIT
E0798Mo-02 96 Well

Mouse Prothymosin Alpha, PTMa ELISA KIT

Ask
View Details
Mouse Prothymosin Alpha, PTMa ELISA KIT
E0798Mo-03 5x 96 Tests

Mouse Prothymosin Alpha, PTMa ELISA KIT

Ask
View Details
Mouse Prothymosin Alpha, PTMa ELISA KIT
E0798Mo-04 10x 96 Tests

Mouse Prothymosin Alpha, PTMa ELISA KIT

Ask
View Details
Wnt-C59
27780-3 5 mg

Wnt-C59

Ask
View Details
Total Iron-binding Capacity Microplate Assay Kit
RDSM222 100 Assays

Total Iron-binding Capacity Microplate Assay Kit

Ask
View Details