Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma Receptor 1/IFNGR1 (C-6His)

Source: Human Cells. MW :28.7kD. Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus. Interferon gamma receptor 1 (IFNGR1) encoded by the IFNGR1 gene, is a single-pass type 1 membrane protein which belongs to the type II cytokine receptor family. IFNGR1 is phosphorylated at Ser/Thr residues after translation. IFNGR1 is a receptor for interferon gamma, two receptors bind one interferon gama dimer. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Product Specifications

Gene Name

IFNGR1

Gene ID

3459

UniProt

P15260

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [PE]
NBP1-43385PE 0.1 mL

Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [PE]

Ask
View Details
Mouse Monoclonal hnRNP A2B1 Antibody (DP3B3)
NB120-6102SS 0.025 mL

Mouse Monoclonal hnRNP A2B1 Antibody (DP3B3)

Ask
View Details
PDE11A (Dual 3',5'-cyclic-AMP and-GMP Phosphodiesterase 11A, cAMP and cGMP Phosphodiesterase 11A) (Biotin)
MBS6444723-01 0.1 mL

PDE11A (Dual 3',5'-cyclic-AMP and-GMP Phosphodiesterase 11A, cAMP and cGMP Phosphodiesterase 11A) (Biotin)

Ask
View Details
PDE11A (Dual 3',5'-cyclic-AMP and-GMP Phosphodiesterase 11A, cAMP and cGMP Phosphodiesterase 11A) (Biotin)
MBS6444723-02 5x 0.1 mL

PDE11A (Dual 3',5'-cyclic-AMP and-GMP Phosphodiesterase 11A, cAMP and cGMP Phosphodiesterase 11A) (Biotin)

Ask
View Details
HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) (MaxLight 650)
128072-ML650 100 µL

HS3ST1 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 1, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 1, 3-OST-1, Heparan Sulfate 3-O-sulfotransferase 1, h3-OST-1, 3OST, 3OST1) (MaxLight 650)

Ask
View Details
FBXO9, CT (FBXO9, FBX9, VCIA1, F-box only protein 9, Cross-immune reaction antigen 1, Renal carcinoma antigen NY-REN-57) (MaxLight 650)
MBS6298513-01 0.1 mL

FBXO9, CT (FBXO9, FBX9, VCIA1, F-box only protein 9, Cross-immune reaction antigen 1, Renal carcinoma antigen NY-REN-57) (MaxLight 650)

Ask
View Details