Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)

Source: Human Cells. MW :44.7kD. Recombinant Mouse 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Val24-Leu187 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is a member of the tumor necrosis factor (TNF) receptor family. It can be induced by lymphocyte activation (ILA) and is expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, TNFRSF9 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. As receptor for TNFSF9/4-1BBL, it can activate T cells and the cross-linking of this protein can enhance T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice.

Product Specifications

Gene Name

Tnfrsf9

Gene ID

21942

UniProt

P20334

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Btbd17 3'UTR GFP Stable Cell Line
TU152875 1.0 mL

Btbd17 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human PTPN3 shRNA (UAS) - Lentiviral human PTPN3 shRNA (UAS) (25)
GTR15345956 1 Vial

Lentiviral human PTPN3 shRNA (UAS) - Lentiviral human PTPN3 shRNA (UAS) (25)

Sign In for Pricing
View Details
TM242 Rabbit Polyclonal Antibody
BT-AP05165-01 20 µL

TM242 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TM242 Rabbit Polyclonal Antibody
BT-AP05165-02 50 µL

TM242 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TM242 Rabbit Polyclonal Antibody
BT-AP05165-03 100 µL

TM242 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CU-CPT22 25mg
A20148-25 25 mg

CU-CPT22 25mg

Sign In for Pricing
View Details