Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)

Source: Human Cells. MW :44.7kD. Recombinant Mouse 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Val24-Leu187 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is a member of the tumor necrosis factor (TNF) receptor family. It can be induced by lymphocyte activation (ILA) and is expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, TNFRSF9 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. As receptor for TNFSF9/4-1BBL, it can activate T cells and the cross-linking of this protein can enhance T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice.

Product Specifications

Gene Name

Tnfrsf9

Gene ID

21942

UniProt

P20334

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ubiquitin Specific Peptidase 8 (USP8) Antibody
abx031545-01 80 µL

Ubiquitin Specific Peptidase 8 (USP8) Antibody

Ask
View Details
Ubiquitin Specific Peptidase 8 (USP8) Antibody
abx031545-02 400 µL

Ubiquitin Specific Peptidase 8 (USP8) Antibody

Ask
View Details
KRT28 (NM_181535) Human Tagged ORF Clone
RG217554 10 µg

KRT28 (NM_181535) Human Tagged ORF Clone

Ask
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) APT Polyclonal Antibody
MBS7138026 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) APT Polyclonal Antibody

Ask
View Details
KDM2B-IN-4
MF-0141632-01 25 mg

KDM2B-IN-4

Ask
View Details
KDM2B-IN-4
MF-0141632-02 50 mg

KDM2B-IN-4

Ask
View Details