Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)

Source: Human Cells. MW :44.7kD. Recombinant Mouse 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Val24-Leu187 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is a member of the tumor necrosis factor (TNF) receptor family. It can be induced by lymphocyte activation (ILA) and is expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, TNFRSF9 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. As receptor for TNFSF9/4-1BBL, it can activate T cells and the cross-linking of this protein can enhance T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice.

Product Specifications

Gene Name

Tnfrsf9

Gene ID

21942

UniProt

P20334

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9329070-01 48 Well

Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9329070-02 96 Well

Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9329070-03 5x 96 Well

Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit
MBS9329070-04 10x 96 Well

Mouse Thioredoxin-like protein 4B, TXNL4B ELISA Kit

Sign In for Pricing
View Details
Human Vitamin D Receptor, VD R ELISA Kit
MBS704497-01 24 Well (LIMIT 1)

Human Vitamin D Receptor, VD R ELISA Kit

Sign In for Pricing
View Details
Human Vitamin D Receptor, VD R ELISA Kit
MBS704497-02 48 Well

Human Vitamin D Receptor, VD R ELISA Kit

Sign In for Pricing
View Details