Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)

Source: Human Cells. MW :44.7kD. Recombinant Mouse 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Val24-Leu187 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is a member of the tumor necrosis factor (TNF) receptor family. It can be induced by lymphocyte activation (ILA) and is expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, TNFRSF9 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. As receptor for TNFSF9/4-1BBL, it can activate T cells and the cross-linking of this protein can enhance T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice.

Product Specifications

Gene Name

Tnfrsf9

Gene ID

21942

UniProt

P20334

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CPXM2 Antibody
MBS9506160-01 0.05 mL

CPXM2 Antibody

Ask
View Details
CPXM2 Antibody
MBS9506160-02 0.1 mL

CPXM2 Antibody

Ask
View Details
CPXM2 Antibody
MBS9506160-03 5x 0.1 mL

CPXM2 Antibody

Ask
View Details
Monoclonal Antibody to FSH Receptor (Clone: ABM5D29)
10-7600-25 25 µg

Monoclonal Antibody to FSH Receptor (Clone: ABM5D29)

Ask
View Details
APC/Fire™ 810  anti-human CD20
GT15624 25 Tests

APC/Fire™ 810 anti-human CD20

Ask
View Details
ASF1A Knockout A549 Polyclonal Cells
ARG31820 1 Million

ASF1A Knockout A549 Polyclonal Cells

Ask
View Details