Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD28//TP44 (C-Fc-6His)

Source: Human Cells. MW :43kD. Recombinant Mouse CD28 is produced by our Mammalian expression system and the target gene encoding Asn20-Lys149 is expressed with a Fc, 6His tag at the C-terminus. T-cell-specific surface glycoprotein CD28, contains an Ig-like V-type domain. CD28 is one of the proteins expressed on T cells that provide co-stimulatory signals, which are required for their activation. It is the receptor for CD80 and CD86. When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs) . The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells. It involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Product Specifications

Gene Name

Cd28

Gene ID

12487

UniProt

P31041

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SUV39H2 Antibody
NBP1-57056 100 µL

Rabbit Polyclonal SUV39H2 Antibody

Sign In for Pricing
View Details
Olr810 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7336204 1.0 µg DNA

Olr810 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
KIAA0774 Protein Vector (Human) (pPM-C-HA)
PV022459 500 ng

KIAA0774 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Clostridium Acetobutylicum rpsI Protein (aa 1-130)
VAng-Lsx7832-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Acetobutylicum rpsI Protein (aa 1-130)

Sign In for Pricing
View Details
Recombinant Salmonella dublin 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1075103-01 0.02 mg (E-Coli)

Recombinant Salmonella dublin 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Salmonella dublin 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1075103-02 0.02 mg (Yeast)

Recombinant Salmonella dublin 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details