Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD28//TP44 (C-Fc-6His)

Source: Human Cells. MW :43kD. Recombinant Mouse CD28 is produced by our Mammalian expression system and the target gene encoding Asn20-Lys149 is expressed with a Fc, 6His tag at the C-terminus. T-cell-specific surface glycoprotein CD28, contains an Ig-like V-type domain. CD28 is one of the proteins expressed on T cells that provide co-stimulatory signals, which are required for their activation. It is the receptor for CD80 and CD86. When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs) . The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells. It involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Product Specifications

Gene Name

Cd28

Gene ID

12487

UniProt

P31041

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysyl-tRNA Synthetase (KARS) Antibody
abx302563-01 20 µg

Lysyl-tRNA Synthetase (KARS) Antibody

Sign In for Pricing
View Details
Lysyl-tRNA Synthetase (KARS) Antibody
abx302563-02 50 µg

Lysyl-tRNA Synthetase (KARS) Antibody

Sign In for Pricing
View Details
Lysyl-tRNA Synthetase (KARS) Antibody
abx302563-03 100 µg

Lysyl-tRNA Synthetase (KARS) Antibody

Sign In for Pricing
View Details
Lysyl-tRNA Synthetase (KARS) Antibody
abx302563-04 200 µg

Lysyl-tRNA Synthetase (KARS) Antibody

Sign In for Pricing
View Details
Lysyl-tRNA Synthetase (KARS) Antibody
abx302563-05 1 mg

Lysyl-tRNA Synthetase (KARS) Antibody

Sign In for Pricing
View Details
Mouse Immunoglobulin E ELISA Kit
MBS9425760-01 96 Tests

Mouse Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details