Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His)

Source: HEK293. MW :43.2kD. Recombinant Human IL-17A &IL-17F Heterodimer is produced by our Mammalian expression system and the target gene encoding Ile20-Ala155&Arg31-Gln163 is expressed with a 6His tag at the C-terminus. The IL-17 family include IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F. The family is comprised of at least six proinflammatory cytokines that share a conserved cysteine-knot structure but diverge at the N-terminus. All members of the IL-17 family have a similar protein structure, with four highly conserved cysteine residues critical to their 3-dimensional shape, yet they have no sequence similarity to any other known cytokines. IL-17 family members are glycoproteins secreted as dimers that induce local cytokine production and recruit granulocytes to sites of inflammation. IL-17 is induced by IL-15 and IL-23, mainly in activated CD4+ T cells distinct from Th1 or Th2 cells. IL-17F is the most homologous to IL-17, but is induced only by IL-23 in activated monocytes.

Product Specifications

Gene Name

IL17A

Gene ID

3605

UniProt

Q16552

Components

Protein in sterile PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween-80.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Protein should be stored at -20°C, though stable at room temperature for 3 weeks. Dilute in PBS.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTSTLPFSPQVSTPRSKFKRISSEFAATMTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMTSTLPFSPQVSTPRSKFKRISSVLSIEFAATMTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD63 Antibody (SPM524) [DyLight 650]
NBP2-34779C 0.1 mL

Mouse Monoclonal CD63 Antibody (SPM524) [DyLight 650]

Ask
View Details
CD46 (NM_172354) Human Tagged Lenti ORF Clone
RC221054L4 10 µg

CD46 (NM_172354) Human Tagged Lenti ORF Clone

Ask
View Details
Recombinant Human Synuclein Alpha (SNCa)
RPU55272-01 50 µg

Recombinant Human Synuclein Alpha (SNCa)

Ask
View Details
Recombinant Human Synuclein Alpha (SNCa)
RPU55272-02 100 µg

Recombinant Human Synuclein Alpha (SNCa)

Ask
View Details
Recombinant Human Synuclein Alpha (SNCa)
RPU55272-03 1 mg

Recombinant Human Synuclein Alpha (SNCa)

Ask
View Details
Lentiviral human NLRP13 shRNA (UAS) - Lentiviral human NLRP13 shRNA (UAS, RFP) (25)
GTR15332990 1 Vial

Lentiviral human NLRP13 shRNA (UAS) - Lentiviral human NLRP13 shRNA (UAS, RFP) (25)

Ask
View Details