Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma/IFN-gamma

Source: Human Cells. MW :16.8kD. Recombinant Human Interferon gamma is produced by our Mammalian expression system and the target gene encoding Gln24-Gln166 is expressed. IFN gamma is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNg synthesis is induced by IL-2, FGF-basic, and EGF.

Product Specifications

Gene Name

IFNG

Gene ID

3458

UniProt

P01579

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 1.5 x 10^7 IU/mg.

Amino Acids

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL11 3'UTR Lenti-reporter-Luc Vector
15343081 1.0 µg

CCL11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit Monoclonal CD40 Ligand/TNFSF5 Antibody (hu5c8 (Ruplizumab)) [DyLight 680]
NBP2-52678FR 0.1 mL

Rabbit Monoclonal CD40 Ligand/TNFSF5 Antibody (hu5c8 (Ruplizumab)) [DyLight 680]

Sign In for Pricing
View Details
Mothers against decapentaplegic homolog 5 (SMAD5) Human ELISA Kit
F0915 96 Tests

Mothers against decapentaplegic homolog 5 (SMAD5) Human ELISA Kit

Sign In for Pricing
View Details
SEMA6D (NM_020858) Human Tagged ORF Clone Lentiviral Particle
RC224394L3V 200 µL

SEMA6D (NM_020858) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal INSM1 Antibody [DyLight 350]
NBP1-76307UV 0.1 mL

Rabbit Polyclonal INSM1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Mmu-miR-7003-5p miRNA Agomir
CMN1477-01 5 nmol

Mmu-miR-7003-5p miRNA Agomir

Sign In for Pricing
View Details