Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma/IFN-gamma

Source: Human Cells. MW :16.8kD. Recombinant Human Interferon gamma is produced by our Mammalian expression system and the target gene encoding Gln24-Gln166 is expressed. IFN gamma is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNg synthesis is induced by IL-2, FGF-basic, and EGF.

Product Specifications

Gene Name

IFNG

Gene ID

3458

UniProt

P01579

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 1.5 x 10^7 IU/mg.

Amino Acids

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CASP4 (Caspase 4) ELISA Kit
E-EL-H0660-01 24 Tests

Human CASP4 (Caspase 4) ELISA Kit

Ask
View Details
Human CASP4 (Caspase 4) ELISA Kit
E-EL-H0660-02 48 Tests

Human CASP4 (Caspase 4) ELISA Kit

Ask
View Details
Human CASP4 (Caspase 4) ELISA Kit
E-EL-H0660-03 96 Tests

Human CASP4 (Caspase 4) ELISA Kit

Ask
View Details
USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 750) discontinued
135141-ML750 100 µL

USF2 (Upstream Stimulatory Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Upstream Transcription Factor 2) (MaxLight 750) discontinued

Ask
View Details
Mouse Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15) ELISA Kit
MBS9900483-01 48 Well

Mouse Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15) ELISA Kit

Ask
View Details
Mouse Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15) ELISA Kit
MBS9900483-02 96 Well

Mouse Sialic Acid Binding Ig Like Lectin 15 (SIGLEC15) ELISA Kit

Ask
View Details