Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (C-6His)

Source: Human Cells. MW :14.4kD. Recombinant Human Cystatin C is produced by our Mammalian expression system and the target gene encoding Ser27-Ala146 is expressed with a 6His tag at the C-terminus. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM Nacl, pH6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDAVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KDM5D Knockout SK-Hep-1 Polyclonal Cells
ARG36689 1 Million

KDM5D Knockout SK-Hep-1 Polyclonal Cells

Ask
View Details
GSTT1/4 Rabbit Polyclonal Antibody
E28PT2084 100 µL

GSTT1/4 Rabbit Polyclonal Antibody

Ask
View Details
Human HepatitisG Virus IgM antibody (HGV-IgM) ELISA Kit
YP-W15895-01 48 Tests

Human HepatitisG Virus IgM antibody (HGV-IgM) ELISA Kit

Ask
View Details
Human HepatitisG Virus IgM antibody (HGV-IgM) ELISA Kit
YP-W15895-02 96 Tests

Human HepatitisG Virus IgM antibody (HGV-IgM) ELISA Kit

Ask
View Details
Hyaluronic Acid dp2 (Hyaluronic Acid Disaccharide)
H7980-20 1 mg

Hyaluronic Acid dp2 (Hyaluronic Acid Disaccharide)

Ask
View Details
SEPT3 discontinued
333725 100 µL

SEPT3 discontinued

Ask
View Details