Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin C/CST3 (C-6His)

Source: Human Cells. MW :14.4kD. Recombinant Human Cystatin C is produced by our Mammalian expression system and the target gene encoding Ser27-Ala146 is expressed with a 6His tag at the C-terminus. Cystatin C is a member of family 2 of the cystatin superfamily. It is ubiquitous in human tissues and body fluids and mainly used as a biomarker of kidney function. Cystatin C inhibits many cysteine proteases such as papain and Cathepsins B, H, K, L and S. As an inhibitor of cysteine proteinases, Cystatin C is thought to serve an important physiological role as a local regulator of this enzyme activity. Recently, it has been studied for its role in predicting new-onset or deteriorating cardiovascular disease. It also seems to play a role in brain disorders involving amyloid (a specific type of protein deposition), such as Alzheimer's disease.

Product Specifications

Gene Name

CST3

Gene ID

1471

UniProt

P01034

Components

Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM Nacl, pH6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDAVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IMP3 (IGF2BP3) Mouse Monoclonal Antibody [Clone ID: LBI4H5]
AMM20283V 100 µL

IMP3 (IGF2BP3) Mouse Monoclonal Antibody [Clone ID: LBI4H5]

Ask
View Details
Recombinant Bradyrhizobium sp. GTPase Era (era)
MBS1024559-01 0.05 mg (E-Coli)

Recombinant Bradyrhizobium sp. GTPase Era (era)

Ask
View Details
Recombinant Bradyrhizobium sp. GTPase Era (era)
MBS1024559-02 0.05 mg (Yeast)

Recombinant Bradyrhizobium sp. GTPase Era (era)

Ask
View Details
Recombinant Bradyrhizobium sp. GTPase Era (era)
MBS1024559-03 0.2 mg (E-Coli)

Recombinant Bradyrhizobium sp. GTPase Era (era)

Ask
View Details
Recombinant Bradyrhizobium sp. GTPase Era (era)
MBS1024559-04 0.05 mg (Baculovirus)

Recombinant Bradyrhizobium sp. GTPase Era (era)

Ask
View Details
Recombinant Bradyrhizobium sp. GTPase Era (era)
MBS1024559-05 0.5 mg (E-Coli)

Recombinant Bradyrhizobium sp. GTPase Era (era)

Ask
View Details