Recombinant Human beta-Nerve Growth Factor/ beta-NGF (Ser122-Arg239, Human Cells)
Source: Human Cells. MW :13.5kD. Recombinant Human beta-Nerve Growth Factor is produced by our Mammalian expression system and the target gene encoding Ser122-Arg239 is expressed. Human beta -Nerve Growth Factor (beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha , beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Product Specifications
Gene Name
NGF
Gene ID
4803
UniProt
P01138
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items