Recombinant Human Leydig Insulin-Like 3/INSL3 (C-6His)
Source: Human Cells. MW :13.4kD. Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.
Product Specifications
Gene Name
INSL3
Gene ID
3640
UniProt
P51460
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items