Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leydig Insulin-Like 3/INSL3 (C-6His)

Source: Human Cells. MW :13.4kD. Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.

Product Specifications

Gene Name

INSL3

Gene ID

3640

UniProt

P51460

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OPA1 (NM_015560) Human Over-expression Lysate
LC414474 20 µg

OPA1 (NM_015560) Human Over-expression Lysate

Ask
View Details
Human TROAP Knockout HEK293T cell line
GTR15402477 1 Vial

Human TROAP Knockout HEK293T cell line

Ask
View Details
FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2015094-01 0.1 mL

FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)

Ask
View Details
FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2015094-02 0.2 mL

FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)

Ask
View Details
FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2015094-03 0.5 mL

FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)

Ask
View Details
FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)
MBS2015094-04 1 mL

FITC-linked Antibody to Mucin 5 Subtype AC (MUC5AC)

Ask
View Details