Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leydig Insulin-Like 3/INSL3 (C-6His)

Source: Human Cells. MW :13.4kD. Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.

Product Specifications

Gene Name

INSL3

Gene ID

3640

UniProt

P51460

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
38406121 3x 1.0µg DNA

RAD1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
5-Aminovaleric Acid
B2015817 1 g

5-Aminovaleric Acid

Sign In for Pricing
View Details
MMAA (NM_172250) Human Untagged Clone
SC101283 10 µg

MMAA (NM_172250) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Bcl7c Pre-designed siRNA Set A
SI101388A 1 Each

Mouse Bcl7c Pre-designed siRNA Set A

Sign In for Pricing
View Details
GCS-alpha-1 discontinued
536679-01 30ul

GCS-alpha-1 discontinued

Sign In for Pricing
View Details
GCS-alpha-1 discontinued
536679-02 100 µL

GCS-alpha-1 discontinued

Sign In for Pricing
View Details