Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leydig Insulin-Like 3/INSL3 (C-6His)

Source: Human Cells. MW :13.4kD. Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.

Product Specifications

Gene Name

INSL3

Gene ID

3640

UniProt

P51460

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SF1670 25mg
A13475-25 25 mg

SF1670 25mg

Ask
View Details
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: UMAB186]
UM800078 100 µL

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: UMAB186]

Ask
View Details
HNF-1beta Polyclonal Antibody
MBS9245700-01 0.1 mL

HNF-1beta Polyclonal Antibody

Ask
View Details
HNF-1beta Polyclonal Antibody
MBS9245700-02 5x 0.1 mL

HNF-1beta Polyclonal Antibody

Ask
View Details
Denintuzumab (Anti-CD19)
C00558-01 1 mg

Denintuzumab (Anti-CD19)

Ask
View Details
Denintuzumab (Anti-CD19)
C00558-02 5x 1 mg

Denintuzumab (Anti-CD19)

Ask
View Details