Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Motilin (C-6His)

Source: Human Cells. MW :11.4kD. Recombinant Human Motilin is produced by our Mammalian expression system and the target gene encoding Phe26-Lys115 is expressed with a 6His tag at the C-terminus. Promotilin is a 115 amino acids protein that belongs to the motilin family. It is a secreted protein that plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.

Product Specifications

Gene Name

MLN

Gene ID

4295

UniProt

P12872

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse GT (Gastrin) ELISA Kit
MBS2533497-01 24 Tests (Limit 1)

Mouse GT (Gastrin) ELISA Kit

Ask
View Details
Mouse GT (Gastrin) ELISA Kit
MBS2533497-02 48 Tests

Mouse GT (Gastrin) ELISA Kit

Ask
View Details
Mouse GT (Gastrin) ELISA Kit
MBS2533497-03 96 Tests

Mouse GT (Gastrin) ELISA Kit

Ask
View Details
Mouse GT (Gastrin) ELISA Kit
MBS2533497-04 5x 96 Tests

Mouse GT (Gastrin) ELISA Kit

Ask
View Details
Mouse GT (Gastrin) ELISA Kit
MBS2533497-05 10x 96 Tests

Mouse GT (Gastrin) ELISA Kit

Ask
View Details
CIT, CT (Citron Rho-interacting Kinase, CRIK, Serine/Threonine-protein Kinase 21, KIAA0949, STK21) (APC) discontinued
C5804-20A-APC 200 µL

CIT, CT (Citron Rho-interacting Kinase, CRIK, Serine/Threonine-protein Kinase 21, KIAA0949, STK21) (APC) discontinued

Ask
View Details