Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Placenta Growth Factor/PGF/PIGF (C-6His)

Source: Human Cells. MW :16.9kD. Recombinant Mouse Placenta growth factor is produced by our Mammalian expression system and the target gene encoding Val19-Pro158 is expressed with a 6His tag at the C-terminus. Placental growth factor is a protein that in humans is encoded by the PGF gene. It is a secreted protein and belongs to the PDGF/VEGF growth factor family. The protein is a member of the VEGF (vascular endothelial growth factor) sub-family-a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis. The main source of PGF during pregnancy is the placental trophoblast. PGF is also expressed in many other tissues, including the villous trophoblast.

Product Specifications

Gene Name

Pgf

Gene ID

18654

UniProt

P49764

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP3 Polyclonal Antibody
MBS8593185-01 0.1 mg

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody
MBS8593185-02 0.1 mL (AF405L)

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody
MBS8593185-03 0.1 mL (AF405S)

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody
MBS8593185-04 0.1 mL (AF610)

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody
MBS8593185-05 0.1 mL (AF635)

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP3 Polyclonal Antibody
MBS8593185-06 0.1 mL (APC)

IGFBP3 Polyclonal Antibody

Sign In for Pricing
View Details