Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-Rich Repeat-Containing Protein 25/LRRC25 (C-6His)

Source: Human Cells. MW :16.7kD. Recombinant Human LRRC25 is produced by our Mammalian expression system and the target gene encoding Leu21-Thr165 is expressed with a 6His tag at the C-terminus. Leucine-rich repeat-containing protein 25 (LRRC25) is a single-pass type I membrane protein and contains 3 LRR (leucine-rich) repeats. The protein expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and appendix but not in thymus. The protein may be involved in the activation of cells of innate and acquired immunity.

Product Specifications

Gene Name

LRRC25

Gene ID

126364

UniProt

Q8N386

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-01 0.2 mL

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details
ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-02 0.1 mL (AF405L)

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details
ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-03 0.1 mL (AF405S)

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details
ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-04 0.1 mL (AF610)

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details
ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-05 0.1 mL (AF635)

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details
ACY1 Antibody (Rabbit Polyclonal)
MBS8508981-06 0.1 mL (APC)

ACY1 Antibody (Rabbit Polyclonal)

Ask
View Details