Recombinant Human NPDC1/CAB1 (C-6His)

Source: Human Cells. MW :16.5kD. Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus. Neural proliferation differentiation and control protein 1 (NPDC1) is a protein that in humans is encoded by the NPDC1 gene. It is a single-pass membrane protein and belongs to the NPDC1/cab-1 family. The protein strongly expressed in adult brain and especially in hippocampus, frontal lobe and temporal lobe. The protein suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation and it might be involved in transcriptional regulation.

Product Specifications

Gene Name

NPDC1

Gene ID

56654

UniProt

Q9NQX5

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH