Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal Acetylcholine Receptor Subunit beta-3/CHRNB3 (C-6His)

Source: Human Cells. MW :25.3kD. Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed with a 6His tag at the C-terminus. Neuronal acetylcholine receptor subunit beta-3 (CHRNB3) is a cell membrane protein and belongs to the ligand-gated ion channel (TC 1.A.9) family. CHRNB3 seems to be composed of two different type of subunits: alpha and beta. The CHRNB3 are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of CHRNB3 are encoded by separate genes and have different primary structure. There are several subtypes of neuronal CHRNB3 that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if like muscle alpha-1, they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits.

Product Specifications

Gene Name

CHRNB3

Gene ID

1142

UniProt

Q05901

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLLDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

1 impurity 5-13C,d3
TRC-I584840-25MG 25 mg

1 impurity 5-13C,d3

Sign In for Pricing
View Details
Celastrol
GP7348-50mg 50 mg

Celastrol

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)
MBS1202981-01 0.02 mg (E-Coli)

Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)
MBS1202981-02 0.1 mg (E-Coli)

Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)
MBS1202981-03 0.02 mg (Yeast)

Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)

Sign In for Pricing
View Details
Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)
MBS1202981-04 0.1 mg (Yeast)

Recombinant Citrobacter koseri Probable transcriptional regulatory protein CKO_01097 (CKO_01097)

Sign In for Pricing
View Details