Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 (C-Fc)

Source: Human Cells. MW :41.5kD. Recombinant Human Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Fc tag at the C-terminus. Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily. Human or mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence.It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Product Specifications

Gene Name

CTLA4

Gene ID

1493

UniProt

P16410

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticam1 (NM_174989) Mouse Tagged Lenti ORF Clone
MR210343L4 10 µg

Ticam1 (NM_174989) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Murine RELMa Rabbit Polyclonal Antibody
TA328551 100 µg

Anti-Murine RELMa Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HDAC1 Antibody (PCRP-HDAC1-1B7) [Alexa Fluor 488]
NBP3-14062AF488 0.1 mL

Mouse Monoclonal HDAC1 Antibody (PCRP-HDAC1-1B7) [Alexa Fluor 488]

Sign In for Pricing
View Details
Human FAM181B Pre-designed siRNA Set B
SI005358B 1 Each

Human FAM181B Pre-designed siRNA Set B

Sign In for Pricing
View Details
Riok1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4615707 1.0 µg DNA

Riok1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-ALLC  (3D3)
YF-MA18842 100 ug

Anti-ALLC (3D3)

Sign In for Pricing
View Details