Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease T2/RNASET2 (C-6His)

Source: Human Cells. MW :28.2kD. Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus. RNASET2, also known as RNASE6PL, is short for bonuclease T2. It is a 256 aa. protein which belongs to the RNase T2 family. RNASET2 is a secreted protein, and is higher expressed in the temporal lobe and fetal brain. This protein can be inhibited by Zn2+ and Cu2+. It has ribonuclease activity, with higher activity at acidic pH and is probably involved in lysosomal degradation of ribosomal RNA. It also plays a role in cellular RNA catabolism.

Product Specifications

Gene Name

RNASET2

Gene ID

8635

UniProt

O00584

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal MUC5AC Antibody (rMUC5AC/8052) [Allophycocyanin]
NBP3-24092APC 0.1 mL

Mouse Monoclonal MUC5AC Antibody (rMUC5AC/8052) [Allophycocyanin]

Ask
View Details
Polyclonal Ab production - goat
20442088-1 1 Custom

Polyclonal Ab production - goat

Ask
View Details
GFAP Protein, Mouse, Recombinant (His & SUMO)
MF-0104568-01 5 µg

GFAP Protein, Mouse, Recombinant (His & SUMO)

Ask
View Details
GFAP Protein, Mouse, Recombinant (His & SUMO)
MF-0104568-02 10 µg

GFAP Protein, Mouse, Recombinant (His & SUMO)

Ask
View Details
GFAP Protein, Mouse, Recombinant (His & SUMO)
MF-0104568-03 20 µg

GFAP Protein, Mouse, Recombinant (His & SUMO)

Ask
View Details
GFAP Protein, Mouse, Recombinant (His & SUMO)
MF-0104568-04 50 µg

GFAP Protein, Mouse, Recombinant (His & SUMO)

Ask
View Details