Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease T2/RNASET2 (C-6His)

Source: Human Cells. MW :28.2kD. Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus. RNASET2, also known as RNASE6PL, is short for bonuclease T2. It is a 256 aa. protein which belongs to the RNase T2 family. RNASET2 is a secreted protein, and is higher expressed in the temporal lobe and fetal brain. This protein can be inhibited by Zn2+ and Cu2+. It has ribonuclease activity, with higher activity at acidic pH and is probably involved in lysosomal degradation of ribosomal RNA. It also plays a role in cellular RNA catabolism.

Product Specifications

Gene Name

RNASET2

Gene ID

8635

UniProt

O00584

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PAF Receptor (PTAFR) (NM_001164721) Human Tagged ORF Clone Lentiviral Particle
RC228830L2V 200 µL

PAF Receptor (PTAFR) (NM_001164721) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (PE)
MBS6185489-01 0.1 mL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (PE)

Ask
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (PE)
MBS6185489-02 5x 0.1 mL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (PE)

Ask
View Details
Zebrafish HSPA8 (C-Term) Rabbit pAb
MBS8558490-01 0.1 mL

Zebrafish HSPA8 (C-Term) Rabbit pAb

Ask
View Details
Zebrafish HSPA8 (C-Term) Rabbit pAb
MBS8558490-02 0.1 mL (AF405L)

Zebrafish HSPA8 (C-Term) Rabbit pAb

Ask
View Details
Zebrafish HSPA8 (C-Term) Rabbit pAb
MBS8558490-03 0.1 mL (AF405S)

Zebrafish HSPA8 (C-Term) Rabbit pAb

Ask
View Details