Recombinant Human Coiled-Coil Domain-Containing Protein 134/CCDC134 (C-6His)

Source: Human Cells. MW :25.3kD. Recombinant Human CCDC134 is produced by our Mammalian expression system and the target gene encoding Thr23-Leu229 is expressed with a 6His tag at the C-terminus. CCDC134, which is short for Coiled-coil domain-containing protein 134, belongs to the UPF0388 family. It is a 229 aa. protein with a 22 aa. signal peptide, and the last 207 aa. is Coiled-coil domain. This protein is usually expressed in extracellular region.

Product Specifications

Gene Name

CCDC134

Gene ID

79879

UniProt

Q9H6E4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELVDHHHHHH