Recombinant Human Coiled-Coil Domain-Containing Protein 134/CCDC134 (C-6His)
Source: Human Cells. MW :25.3kD. Recombinant Human CCDC134 is produced by our Mammalian expression system and the target gene encoding Thr23-Leu229 is expressed with a 6His tag at the C-terminus. CCDC134, which is short for Coiled-coil domain-containing protein 134, belongs to the UPF0388 family. It is a 229 aa. protein with a 22 aa. signal peptide, and the last 207 aa. is Coiled-coil domain. This protein is usually expressed in extracellular region.
Product Specifications
Gene Name
CCDC134
Gene ID
79879
UniProt
Q9H6E4
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELVDHHHHHH
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
