Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pancreatic Polypeptide/PPY (C-6His)

Source: Human Cells. MW :7.8kD. Recombinant Human Pancreatic Polypeptide is produced by our Mammalian expression system and the target gene encoding Ala30-Arg88 is expressed with a 6His tag at the C-terminus. PPY belongs to the NPY family and is synthesized as a 95 aa polypeptide precursor in the pancreatic islets of Langerhans. It is cleaved into two peptide products; the active hormone of 36 aa and an icosapeptide of unknown function. The hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa.

Product Specifications

Gene Name

PPY

Gene ID

5539

UniProt

P01298

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TPD52L2 Protein Vector (Rat) (pPM-C-HA)
47353026 500 ng

TPD52L2 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
Anti-CD22 Antibody
MBS177673-01 0.01 mg

Anti-CD22 Antibody

Ask
View Details
Anti-CD22 Antibody
MBS177673-02 0.1 mg (Carrier Free)

Anti-CD22 Antibody

Ask
View Details
Anti-CD22 Antibody
MBS177673-03 0.1 mg

Anti-CD22 Antibody

Ask
View Details
Anti-CD22 Antibody
MBS177673-04 0.1 mg (Cy3)

Anti-CD22 Antibody

Ask
View Details
Anti-CD22 Antibody
MBS177673-05 0.1 mg (Biotin)

Anti-CD22 Antibody

Ask
View Details