Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein E/ApoE (C-6His)

Source: Human Cells. MW :35.3kD. Recombinant Human Apolipoprotein E is produced by our Mammalian expression system and the target gene encoding Lys19-His317 is expressed with a 6His tag at the C-terminus. ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport .ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma .Apolipoprotein E combines with fats (lipids) in the body to form molecules called lipoproteins and Apolipoprotein E is a major component of a specific type of lipoprotein called very low-density lipoproteins (VLDLs) .

Product Specifications

Gene Name

APOE

Gene ID

348

UniProt

P02649

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF640R conjugate, 0.1mg/mL
BNC402745-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,4-Phenylenediamine-15N2
TRC-P319848-5MG 5 mg

1,4-Phenylenediamine-15N2

Sign In for Pricing
View Details
Human CGBP (CXXC1) activation kit by CRISPRa
GA109391 1 Kit

Human CGBP (CXXC1) activation kit by CRISPRa

Sign In for Pricing
View Details
RealStar®PIV RT-PCR Kit 2.0 RUO
262003 96 Tests

RealStar®PIV RT-PCR Kit 2.0 RUO

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS650426 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ENAH / MENA (Actin Regulator) (ENAH/1988), CF568 conjugate, 0.1mg/mL
BNC681988-100 1x 100 µL

ENAH / MENA (Actin Regulator) (ENAH/1988), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details