Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein E/ApoE (C-6His)

Source: Human Cells. MW :35.3kD. Recombinant Human Apolipoprotein E is produced by our Mammalian expression system and the target gene encoding Lys19-His317 is expressed with a 6His tag at the C-terminus. ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport .ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma .Apolipoprotein E combines with fats (lipids) in the body to form molecules called lipoproteins and Apolipoprotein E is a major component of a specific type of lipoprotein called very low-density lipoproteins (VLDLs) .

Product Specifications

Gene Name

APOE

Gene ID

348

UniProt

P02649

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Troponin I, fast skeletal muscle ELISA Kit
MBS2883299-01 48 Well

Human Troponin I, fast skeletal muscle ELISA Kit

Ask
View Details
Human Troponin I, fast skeletal muscle ELISA Kit
MBS2883299-02 96 Well

Human Troponin I, fast skeletal muscle ELISA Kit

Ask
View Details
Human Troponin I, fast skeletal muscle ELISA Kit
MBS2883299-03 5x 96 Well

Human Troponin I, fast skeletal muscle ELISA Kit

Ask
View Details
Human Troponin I, fast skeletal muscle ELISA Kit
MBS2883299-04 10x 96 Well

Human Troponin I, fast skeletal muscle ELISA Kit

Ask
View Details
L Antibody
A60700-100UL 100 µL

L Antibody

Ask
View Details
Recombinant Human Ketohexokinase/KHK Protein (C-6His)
MBS2552882-01 0.01 mg

Recombinant Human Ketohexokinase/KHK Protein (C-6His)

Ask
View Details