Recombinant Human Acylphosphate Phosphohydrolase 1/ACYP1 (N-6His)
Source: E.coli. MW :13.42kD. Recombinant Human Acylphosphate phosphohydrolase 1 is produced by our E.coli expression system and the target gene encoding Met1-Lys99 is expressed with a 6His tag at the N-terminus. ACYP1, also known as Acylphosphatase-1, Acylphosphatase, erythrocyte isozyme, Acylphosphatase, organ-common type isozyme, Acylphosphate phosphohydrolase 1 and ACYPE, is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates.ACYP1 is a protein which belongs to the acylphosphatase family and contains 1 fibrinogen C-terminal domain. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. Recombinant human ACYP1 protein was expressed in E. coli fused with HIS-tag at N-terminus.
Product Specifications
Gene Name
ACYP1
Gene ID
97
UniProt
P07311
Components
Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,20% Glycerol,1mM DTT, pH8.0.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items