Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acylphosphate Phosphohydrolase 1/ACYP1 (N-6His)

Source: E.coli. MW :13.42kD. Recombinant Human Acylphosphate phosphohydrolase 1 is produced by our E.coli expression system and the target gene encoding Met1-Lys99 is expressed with a 6His tag at the N-terminus. ACYP1, also known as Acylphosphatase-1, Acylphosphatase, erythrocyte isozyme, Acylphosphatase, organ-common type isozyme, Acylphosphate phosphohydrolase 1 and ACYPE, is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates.ACYP1 is a protein which belongs to the acylphosphatase family and contains 1 fibrinogen C-terminal domain. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. Recombinant human ACYP1 protein was expressed in E. coli fused with HIS-tag at N-terminus.

Product Specifications

Gene Name

ACYP1

Gene ID

97

UniProt

P07311

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,20% Glycerol,1mM DTT, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HEY1 Human Recombinant Protein
TP725547 50 µg

HEY1 Human Recombinant Protein

Ask
View Details
FineTest®647 Rat IgG2a, λ Isotype Control (B39-4)
F647-30293-01 20 Tests

FineTest®647 Rat IgG2a, λ Isotype Control (B39-4)

Ask
View Details
FineTest®647 Rat IgG2a, λ Isotype Control (B39-4)
F647-30293-02 100 Tests

FineTest®647 Rat IgG2a, λ Isotype Control (B39-4)

Ask
View Details