Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-H/CCNH (N-6His)

Source: E.coli. MW :39.8kD. Recombinant Human Cyclin-H is produced by our E.coli expression system and the target gene encoding Met1-Leu323 is expressed with a 6His tag at the N-terminus. Human CCNH, also known as Cyclin-H, MO15-associated protein, p34 and p37, is a protein which belongs to the highly conserved cyclin family. Cyclin family members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1.CCNH regulates CDK7 which is the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. CCNH is also involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.

Product Specifications

Gene Name

CCNH

Gene ID

902

UniProt

P51946

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,2mM EDTA,2mM DTT,30%Glycerol, pH8.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-01 0.02 mg (E-Coli)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details
Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-02 0.1 mg (E-Coli)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details
Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-03 0.02 mg (Yeast)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details
Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-04 0.1 mg (Yeast)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details
Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-05 0.02 mg (Baculovirus)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details
Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)
MBS1242773-06 1 mg (E-Coli)

Recombinant Eimeria acervulina EAMZP30-47 protein (CMC17)

Ask
View Details