Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 2/FGF-2/bFGF (Q65I, C96S, N111G)

Source: E. coli. MW :17.2kD. Recombinant Human Thermostable Fibroblast Growth Factor 2 (Q65I, C96S, N111G) is produced by our E.coli expression system and the target gene encoding Met1-Ser155 is expressed. Fibroblast growth factors (FGF) are a family of heparin-binding secreted proteins that stimulate cell proliferation and differentiation in a wide variety of tissues. FGFs play important roles in diverse biological functions both in vivo and in vitro, including mitogenesis, cellular migration, differentiation, angiogenesis, and wound healing. Human embryonic stem cell (hESC) cultures require FGF basic (also known as FGF-2 or bFGF) in cell culture media to remain in an undifferentiated and pluripotent state. Thermostable FGF basic was engineered for enhanced stability in culture media, without modification of its biological function. FGF basic is a required component of stem cell culture media for maintaining cells in an undifferentiated state. Because FGF basic is unstable, daily media changes are needed. The thermostable FGF basic that supports a 2-day media change schedule, so no media changes are required over a weekend. This thermostable FGF basic was more stable than FGF basic in biochemical studies, and maintained cell growth, pluripotency and differentiation potential with a 2-day feeding schedule.

Product Specifications

Gene Name

LEFTY1

Gene ID

10637

UniProt

O75610

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl, pH7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLIAEERGVVSIKGVCANRYLAMKEDGRLLASKSVTDECFFFERLESNGYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF594 conjugate, 0.1mg/mL
BNC940821-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details