Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IA2/PTPRN (Gln607-Asn686 & Trp795-Leu888, N-6His)

Source: E. coli. MW :22.9kD. Recombinant Human PTPRN is produced by our E.coli expression system and the target gene encoding Gln607-Asn686&Trp795-Leu888 is expressed with a 6His tag at the N-terminus. Receptor-type tyrosine-protein phosphatase-like N (PTPRN) belongs to the protein-tyrosine phosphatase family and receptor class 8 subfamily. PTPRN contains 1 tyrosine-protein phosphatase domain, is expressed in neuroendocrine cells only. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. It implicated in neuroendocrine secretory processes. It may be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. It seems to lack intrinsic enzyme activity, may play a role in the regulation of secretory granules via its interaction with SNTB2. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.

Product Specifications

Gene Name

PTPRN

Gene ID

5798

UniProt

Q16849

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANGGGGSGGGGSGGGGSWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLL
More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD45.2 Antibody
MBS4514351-01 0.05 mg

Purified Anti-Mouse CD45.2 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Antibody
MBS4514351-02 0.1 mg

Purified Anti-Mouse CD45.2 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Antibody
MBS4514351-03 5x 0.1 mg

Purified Anti-Mouse CD45.2 Antibody

Sign In for Pricing
View Details
Pank1 (NM_023792) Mouse Tagged Lenti ORF Clone
MR205772L3 10 µg

Pank1 (NM_023792) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Angiopoietin-1 (ANGPT1) Antibody
abx274714-01 50 Tests

Angiopoietin-1 (ANGPT1) Antibody

Sign In for Pricing
View Details
Angiopoietin-1 (ANGPT1) Antibody
abx274714-02 100 Tests

Angiopoietin-1 (ANGPT1) Antibody

Sign In for Pricing
View Details