Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA

Source: E. coli. MW :14.1kD. Recombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed. Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Product Specifications

Gene Name

PDGFA

Gene ID

5154

UniProt

P04085

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TINAG Protein Vector (Human) (pPM-C-HA)
PV042155 500 ng

TINAG Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Imazalil (IMZ)
AT156 1mg

Imazalil (IMZ)

Sign In for Pricing
View Details
COX IV polyclonal antibody
BS90324 50ul

COX IV polyclonal antibody

Sign In for Pricing
View Details
SAHH-3 (m) -PR
sc-106529-PR 10 µM - 20 µL

SAHH-3 (m) -PR

Sign In for Pricing
View Details
CU-CPT17e
BA6298-5 5 mg

CU-CPT17e

Sign In for Pricing
View Details
TMEM63B Protein Vector (Mouse) (pPM-C-HA)
PV239808 500 ng

TMEM63B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details