Recombinant Human Glia Maturation Factor beta/GMF- beta/GMFB (C-6His)

Source: E. coli. MW :17.7kD. Recombinant Human Glia maturation factor beta is produced by our E.coli expression system and the target gene encoding Met1-His142 is expressed with a 6His tag at the C-terminus. Glia maturation factor beta (GMFB) contains a ADF-H domain, which is a member of the actin-binding proteins ADF family, GMF subfamily. It is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. GMFB causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. It is phosphorylated after phorbol ester stimulation, and is crucial for the nervous system. GMFB overexpression in astrocytes results in the increase of BDNF production. GMFB expression is increased by exercise, thus BDNF is important for exercise-induction of BDNF.

Product Specifications

Gene Name

GMFB

Gene ID

2764

UniProt

P60983

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mMNaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFHLEHHHHHH