Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat Shock Protein beta-8//HSPB8 (C-6His)

Source: E. coli. MW :22.7kD. Recombinant Human Heat shock protein beta-8 is produced by our E.coli expression system and the target gene encoding Met1-Thr196 is expressed with a 6His tag at the C-terminus. Heat shock protein beta-8 (HSPB8) belongs to the small heat shock protein (HSP20) family. This protein can be inducted by 17-beta-estradiol, and is predominantly expressed in skeletal muscle and heat, mainly located in the cytoplasm and nucleus. HSPB8 usually exists in monomer, it can interact with HSPB1 and DNAJB6. HSPB8 displays temperature-dependent chaperone activity, appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Product Specifications

Gene Name

HSPB8

Gene ID

26353

UniProt

Q9UJY1

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCTLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SIRT5 Antibody [G24H6]
C15594-01 20 µL

SIRT5 Antibody [G24H6]

Ask
View Details
SIRT5 Antibody [G24H6]
C15594-02 100 µL

SIRT5 Antibody [G24H6]

Ask
View Details
SIRT5 Antibody [G24H6]
C15594-03 2x 100 μL

SIRT5 Antibody [G24H6]

Ask
View Details
Spry1 (BC039139) Mouse Tagged Lenti ORF Clone
MR202508L4 10 µg

Spry1 (BC039139) Mouse Tagged Lenti ORF Clone

Ask
View Details
Alexa Fluor™ 647-Labeled Human Alpha-Synuclein Pre-formed Fibrils Protein, His Tag
ALN-HA1H4-1mg 1 mg

Alexa Fluor™ 647-Labeled Human Alpha-Synuclein Pre-formed Fibrils Protein, His Tag

Ask
View Details
CDK4 Antibody (YA3763, Mouse)
HY-P84066-01 10 µL

CDK4 Antibody (YA3763, Mouse)

Ask
View Details