Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat Shock Protein beta-8//HSPB8 (C-6His)

Source: E. coli. MW :22.7kD. Recombinant Human Heat shock protein beta-8 is produced by our E.coli expression system and the target gene encoding Met1-Thr196 is expressed with a 6His tag at the C-terminus. Heat shock protein beta-8 (HSPB8) belongs to the small heat shock protein (HSP20) family. This protein can be inducted by 17-beta-estradiol, and is predominantly expressed in skeletal muscle and heat, mainly located in the cytoplasm and nucleus. HSPB8 usually exists in monomer, it can interact with HSPB1 and DNAJB6. HSPB8 displays temperature-dependent chaperone activity, appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Product Specifications

Gene Name

HSPB8

Gene ID

26353

UniProt

Q9UJY1

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCTLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

APOB Antibody
A50297-100UL 100 µL

APOB Antibody

Sign In for Pricing
View Details
CA9 Antibody (N-term)
E45G02317G-1 100 µL

CA9 Antibody (N-term)

Sign In for Pricing
View Details
GOLGA6B, ID (GOLGA6B, GOLGA, Putative golgin subfamily A member 6B) (MaxLight 750) discontinued
036161-ML750 100 µL

GOLGA6B, ID (GOLGA6B, GOLGA, Putative golgin subfamily A member 6B) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SsDNA Assay Kit
12645ES76 500 Tests

SsDNA Assay Kit

Sign In for Pricing
View Details
Epstein-Barr Virus (EBNA-1) IgG ELISA Kit
DE4246 96 Tests

Epstein-Barr Virus (EBNA-1) IgG ELISA Kit

Sign In for Pricing
View Details
Mouse Olfr1508 activation kit by CRISPRa
GA206149 1 Kit

Mouse Olfr1508 activation kit by CRISPRa

Sign In for Pricing
View Details