Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 7/FGF-7/KGF

Source: E. coli. MW :19.1kD. Recombinant Human Fibroblast Growth Factor 7 is produced by our E.coli expression system and the target gene encoding Cys32-Thr194 is expressed. Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation.

Product Specifications

Gene Name

FGF7

Gene ID

2252

UniProt

P21781

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH8.0, l50mM NaCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (PE)
MBS6361860-01 0.2 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (PE)

Ask
View Details
USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (PE)
MBS6361860-02 5x 0.2 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (PE)

Ask
View Details
RING1 (RING Finger Protein 1, Ring1A, RNF1) (MaxLight 405)
MBS6197642-01 0.1 mL

RING1 (RING Finger Protein 1, Ring1A, RNF1) (MaxLight 405)

Ask
View Details
RING1 (RING Finger Protein 1, Ring1A, RNF1) (MaxLight 405)
MBS6197642-02 5x 0.1 mL

RING1 (RING Finger Protein 1, Ring1A, RNF1) (MaxLight 405)

Ask
View Details
ADH5 Mouse Monoclonal Antibody [Clone ID: LBI4D4]
AMM19035V 100 µL

ADH5 Mouse Monoclonal Antibody [Clone ID: LBI4D4]

Ask
View Details
Human PABIR3 qPCR Primer Pair
QH66325S 200 Tests

Human PABIR3 qPCR Primer Pair

Ask
View Details